This compilation of Taaooma comedy brings you the most hilarious moments of Teni, with its iconic reactions, fun expressions and a relatable Nigerian family drama. If you love Taaooma’s sketches, this video is full of more fun and laid clips from it playing the character. From classic African mom moments to unexpected hilarious turns, Taooma never stops entertaining! Look how I had life with her strict mother and friends of the most comic forms. The best thing about Teni Taaooma character that will make you cry, don’t forget to like, comment and subscribe to get more Taaooma comedy content! Taaooma, Taaooma Comedy, Taaooma Skets, Taaooma Funny Videos, Taooma Teni, Taooma Best Skits, Best of Taooma, Taaooma Compilation, Taaooma Skit, Taaooma Trends, Taooma New Video, Taaoom Nigerian Skinterian Skinterian, Taaooma Trends, Taooma, Taaoo Taooma Latest, Taooma Viral Video, Taaooma Teni Compilation, Taaooma Instagram Skits, The Thumbs Up Show, So Funny TV, Quadri Taaooma, Quadri Taaoom #TAAOOMA #TENIFUNNSKITS #TAOOMACOMPILATION #BESTAFTAOOOOMA #TAAOOMASKITS #TRENGTAOOOMA #TAAOMAFUNNYMOMENTS DISCOUNT OF RESPONSIBILITY: “All music, images, dances and other content used in this video has a license under creative common ones, used under provisions of fair use or in the public domain. existing author “. Please send me a message about “akinwale14559@gmail.com” If you don’t want your video in this channel and action to be taken immediately. Please do not look for this video for copyright. Thank you.
Check Also
#islamiccontent #hazratalinefarmayaqayamatkinishaniyan #travel #hazrataliakbarkishahadat #hijab
#love #funny #duet #lifeisbutadream #comedy #nothingimpossibleinthisworld #ihavethisthingwithplants #ekmotahathighumechala #sufipoetry #azharmahmood #qazi #sufipoet #eidpoetry #qaribqaribsinglle #cuplet …
JamzNG Latest News, Gist, Entertainment in Nigeria
WATCH BEST OF SABINUS HERE 😂https://youtu.be/F7qXE-Io88w?si=ttUIMdtvmxqDB7wA
Teni,omo lile,onijogbon ❤❤